PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00015.1_g00085.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 266aa    MW: 30010.4 Da    PI: 5.2384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00015.1_g00085.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg WT eEd++lv +++++G g+W+  +r+ g+ R++k+c++rw +yl
  Rsa1.0_00015.1_g00085.1 14 RGGWTDEEDQKLVAYINEYGIGDWRFLPRKAGLQRCGKSCRLRWMNYL 61
                             789*******************************************97 PP

2Myb_DNA-binding56.46.9e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +g++T+eE+e + + +  lG++ W++Ia+ m+ gR+++++k++w++ 
  Rsa1.0_00015.1_g00085.1  67 KGKFTPEEEEAIMNFHSILGNR-WAAIAQQMP-GRSDNDIKNHWNSC 111
                              79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.886961IPR017930Myb domain
SuperFamilySSF466891.8E-3012108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-231668IPR009057Homeodomain-like
CDDcd001679.60E-111761No hitNo description
PROSITE profilePS5129426.21362116IPR017930Myb domain
SMARTSM007172.3E-1566114IPR001005SANT/Myb domain
PfamPF002493.5E-1667111IPR001005SANT/Myb domain
CDDcd001671.54E-1069109No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRATWFDAD GTKRGGWTDE EDQKLVAYIN EYGIGDWRFL PRKAGLQRCG KSCRLRWMNY  60
LRPGVKKGKF TPEEEEAIMN FHSILGNRWA AIAQQMPGRS DNDIKNHWNS CLKKRLERQG  120
INQMTYQPII NLAVKTPSFN IDCGNSSSST VSASPSFSSS GSASLLNRLA TGISSRQHGV  180
DRIKNIFSDP RTAIITGQEE EFEESKKDHG KALASDDQED DFLMWDEENL RRFMEEIGQM  240
DPETNGVCNS SSSSPYGIYE TSLLDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149359.11e-169PREDICTED: transcription repressor MYB6-like
RefseqXP_013641843.11e-169PREDICTED: transcription repressor MYB6-like
TrEMBLA0A078GJM01e-167A0A078GJM0_BRANA; BnaA06g12870D protein
STRINGfgenesh1_pg.C_scaffold_10016921e-124(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.16e-87myb domain protein 47